Bacterial taxon 400667 
						  Locus A1S_3163 
						  Protein ABO13560.2 
					
				
				16S rRNA processing protein
				Acinetobacter baumannii ATCC 17978 
				Length 182 aa, Gene n/a, UniProt n/a
					
				
				
					>ABO13560.2|Acinetobacter baumannii ATCC 17978|16S rRNA processing protein
MTPTQNVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQIVDVKRWKPHGKGLVVALKGVSDRTGAESLVGANIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDDEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVDY
				
				 
				
			
		    
            
              
            	| Host | Tissue | Tissue Ontology | Time Post Infection | Transposon Insertion Site | Raw Fitness Score | p-Value | Fitness z-Score | Precise fitness z-Score | Reference | 
            
            
            
            | Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.7 | 2.9e-12 | ●●●●○ -3.72 | -3.7203584065073985 | 24895306 | 
              
          
		   Retrieved 1 of 1 entries in 0.6 ms
			  (Link to these results)