Bacterial taxon 400667
Locus A1S_3163
Protein ABO13560.2
16S rRNA processing protein
Acinetobacter baumannii ATCC 17978
Length 182 aa, Gene n/a, UniProt n/a
>ABO13560.2|Acinetobacter baumannii ATCC 17978|16S rRNA processing protein
MTPTQNVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQIVDVKRWKPHGKGLVVALKGVSDRTGAESLVGANIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDDEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVDY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.7 | 2.9e-12 | ●●●●○ -3.72 | -3.7203584065073985 | 24895306 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)