Bacterial taxon 400667
Locus A1S_1719
Protein ABO12146.1
4Fe-4S ferredoxin iron-sulfur binding
Acinetobacter baumannii ATCC 17978
Length 81 aa, Gene n/a, UniProt n/a
>ABO12146.1|Acinetobacter baumannii ATCC 17978|4Fe-4S ferredoxin iron-sulfur binding
MAFIFKEVQHRTVAPVIIDEDKCIADKGCTVCVDVCPMDLLAIDPTTQKAYMQFDECWYCMPCEKDCPTNAVKVNIPYLLK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.77 | 0.0042 | ○○○○○ 1.33 | 1.3312913433966775 | 24895306 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)