Bacterial taxon 400667
Locus A1S_3066
Protein ABO13463.2
50S ribosomal protein L6
Acinetobacter baumannii ATCC 17978
Length 177 aa, Gene rplF, UniProt A3M969
>ABO13463.2|Acinetobacter baumannii ATCC 17978|50S ribosomal protein L6
MSRVAKAPVTVPNGVTVTQNGRQVEVKGSKGTLSFNLHALVELKQEEGKLQLAPAKESKDAWMQAGTARAVLNNLVKGVSEGFERKLQLVGVGYKAAVKGTVVNLNLGYSHPIDYALPEGVTAETPTATEIILKSANKQLLGQVAAEIRAYRSPEPYKGKGVRYSDEVILRKEAKKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.94 | 0.00025 | ●●●○○ -2.61 | -2.614097241208701 | 24895306 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)