Bacterial taxon 400667
Locus A1S_1753
Protein ABO12180.2
AdeR
Acinetobacter baumannii ATCC 17978
Length 247 aa, Gene n/a, UniProt n/a
>ABO12180.2|Acinetobacter baumannii ATCC 17978|AdeR
MFDHSFSFDCQDKVILVVEDDYDIGDIIENYLKREGMSVIRAMNGKQAIELHASQPIDLILLDIKLPELNGWEVLNKIRQKAQTPVIMLTALDQDIDKVMALRIGADDFVVKPFNPNEVVARVQAVLRRTQFANKATNKNKLYKNIEIDTDTHSVYIHSENKKILLNLTLTEYKIISFMIDQPHKVFTRGELMNHCMNDSDALERTVDSHVSKLRKKLEEQGIFQMLINVRGVGYRLDNPLAVKDDA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.71 | 5.5e-7 | ○○○○○ 1.26 | 1.257643708947766 | 24895306 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)