Bacterial taxon 400667
Locus A1S_0258
Protein ABO10733.1
argininosuccinate lyase
Acinetobacter baumannii ATCC 17978
Length 37 aa, Gene argH, UniProt A3M1E0
>ABO10733.1|Acinetobacter baumannii ATCC 17978|argininosuccinate lyase
MTLEASVNARDHIGGTSPKQVEAAIARAHKRLEQLYA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.73 | 0.0097 | ●○○○○ -0.85 | -0.854211130426638 | 24895306 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)