Bacterial taxon 400667
Locus A1S_1397
Protein ABO11825.2
ArtM protein
Acinetobacter baumannii ATCC 17978
Length 206 aa, Gene n/a, UniProt n/a
>ABO11825.2|Acinetobacter baumannii ATCC 17978|ArtM protein
MWGLWATAKIAFISVFFSAIFGTVFGVIMTSKNIVVKALCRLYLEAIRIIPILVLLFVFYFGFATWFNWQFSAMWVCVVVFVLWGTAEMGDLVRAAITSIDQHQRDSAYALGLTHVQALIYVIFPQSLKRVTPGAINLFTRMVKTSSLAVLIGVVEVIKVGQQIIENSLLTVPSASLWIYGFIFILYFLICYPLSRLAAHLEKVWE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.42 | 0.047 | ○○○○○ 0.83 | 0.8339663740887847 | 24895306 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)