Bacterial taxon 400667
Locus A1S_1192
Protein ABO11622.1
aspartate carbamoyltransferase non-catalytic chain
Acinetobacter baumannii ATCC 17978
Length 82 aa, Gene n/a, UniProt n/a
>ABO11622.1|Acinetobacter baumannii ATCC 17978|aspartate carbamoyltransferase non-catalytic chain
MALGIQLINEGLFEPLEWVTKVTSAPAQVANMTARWQAEAGWVLVDPELSWTVSKDTILSQGKNTPLLGQKLTGKVLQTFAV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4,47 | 1,5e-66 | ●●●●● -6,29 | -6.29370465531319 | 24895306 |
Retrieved 1 of 1 entries in 0,6 ms
(Link to these results)