Bacterial taxon 400667
Locus A1S_1703
Protein ABO12130.1
dihydrolipoamide dehydrogenase
Acinetobacter baumannii ATCC 17978
Length 54 aa, Gene n/a, UniProt n/a
>ABO12130.1|Acinetobacter baumannii ATCC 17978|dihydrolipoamide dehydrogenase
MVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.65 | 6.7e-23 | ●●●○○ -2.19 | -2.188082596293297 | 24895306 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)