Bacterial taxon 400667
Locus A1S_2037
Protein ABO12464.2
EsvI
Acinetobacter baumannii ATCC 17978
Length 229 aa, Gene n/a, UniProt n/a
>ABO12464.2|Acinetobacter baumannii ATCC 17978|EsvI
MSTLQERMSLAIKHYESETGKRFKNTDLARFAGVSRANVGLWVNGPTQELEGSNLVKAAEFLGVSKDWLAGQSNKMDATKIDNNVSKKVAKLAPVLSWVQAGTFTNVQSVDLSMVEEWLPLPDECTNCFYLKVQGVSNQPDFLEGDYILVDPDVYYSDMQSGDMVVVRRFEDATFKKLVIETDGSRYLQALNPKFEPNIIPLDEHCYFVGQVVDCMRYTYRAKRRTRPN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.79 | 0.0083 | ○○○○○ 1.36 | 1.3636257338202895 | 24895306 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)