Bacterial taxon 400667
Locus A1S_1550
Protein ABO11977.2
glucose-inhibited division protein B
Acinetobacter baumannii ATCC 17978
Length 210 aa, Gene rsmG, UniProt A3M4Y3
>ABO11977.2|Acinetobacter baumannii ATCC 17978|glucose-inhibited division protein B
MHPFFQELQQGSQKLGLSLSDEALTLLLKYQDALVLWNKAYNLTAIRDPKEMLVKHLLDSLSILKDLPAGRLLDVGTGGGMPGMIIALCQPERSCVLLDSNGKKIRFLKQFIADLKLKNVIAVQTRVENQDTIDELGQFDVITSRAFASLTDFVEAARPYLHEQSIIAAMKGLIPVEEMEELKQEFSCKVIELHVPRLDEQRHLLLLQRI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.54 | 0.00016 | ○○○○○ 1 | 1.0013785032453222 | 24895306 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)