Bacterial taxon 400667
Locus A1S_0207
Protein ABO10683.1
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 150 aa, Gene n/a, UniProt n/a
>ABO10683.1|Acinetobacter baumannii ATCC 17978|hypothetical protein
MKKLSDEYLPVRKAQTVYGSISGNYAFRGEKTIWFESTLERDFILKQEFNNNVIDVIGQPVVIPYITELGNQSTYTPDFLVQFSSSNCDDFEDFPVPMLIEIKPKKKLVEDWDKLKPKFRAAHRFAADKGWKFKIISETRLYVGLTHYHL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.43 | 0.005 | ○○○○○ 0.85 | 0.8468872663950632 | 24895306 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)