Bacterial taxon 400667
Locus A1S_0648
Protein ABO11097.1
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 153 aa, Gene n/a, UniProt n/a
>ABO11097.1|Acinetobacter baumannii ATCC 17978|hypothetical protein
MKNIFVLSLALLGAPVAYADFQGKVIKVADGDTLTVLVNGNTQERVRLENIDAPESSQAYGQQARNFLNSQVYGKFVYVKSNKMDLYKRHIGTIYLGNYNINQSIVQNGYAWAFREYLTDPNYIKYEQYARQNRLGLWKDNNPIYPSNWRRSK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.61 | 7.3e-5 | ○○○○○ 1.1 | 1.101586313698395 | 24895306 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)