Bacterial taxon 400667
Locus A1S_1450
Protein ABO11878.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 228 aa, Gene n/a, UniProt n/a
>ABO11878.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MNKSLLEQLSPTNCQVIFIDHQPQMAFGVQSIDRQVLKNNTVGLAKAAKTFNIPVTITTVETESFSGHTYPELLDIFPDAPLLERTSMNSWDDQKVRDSLAKNNRKKVIVSGLWTEVCNNTFAFGAMLEGDYEIYMVADASGGTSKEAHDYAMQRMIQAGVVPVTWQQVLLEWQRDWAHRDTYDAVMAIVREHSGAYGMGVDYAYTMVHKAPERTTSKHEVLAPVPAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.79 | 0.017 | ○○○○○ 1.36 | 1.3640713218350928 | 24895306 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)