Bacterial taxon 400667
Locus A1S_2031
Protein ABO12458.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 156 aa, Gene n/a, UniProt n/a
>ABO12458.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MAALKEPVKIFIVQALACRDTPQEVVEQVKQEFGVDISRSQCECYDPTKYSGRNLSKKFVELFESTREKFDEGLIDIPIANKYYRLKQYQRQLEKTRNVKTALKILEQAAKDIGGQFTNRQEITGKDGGPVQTVNSEIPVPMEDYLKARREVLDEY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.66 | 2.9e-8 | ●●●○○ -2.21 | -2.2081742822129358 | 24895306 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)