Bacterial taxon 400667
Locus A1S_3234
Protein ABO13624.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 197 aa, Gene n/a, UniProt n/a
>ABO13624.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MTQRISEVVRNTNETKIRVRLNLDGTGQGTLNTGVPFLDHMIDQIKRHGLFDIDIHCDGDLEIDDHHTVEDCGITLGQAFAQALGDKKGLRRYGHFYAPLDEALSRVVVDLSGRPGLFMDIPFTRARIGTFDVDLFSEFFQGFVNHALMTLHIDNLKGKNSHHQIESVFKALARALRMACEIDPRAENTIASTKGSL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.69 | 5.0e-31 | ●●●●○ -3.71 | -3.706251389188059 | 24895306 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)