Bacterial taxon 400667
Locus A1S_1263
Protein ABO11691.1
L-2-haloalkanoic acid dehalogenase
Acinetobacter baumannii ATCC 17978
Length 148 aa, Gene n/a, UniProt n/a
>ABO11691.1|Acinetobacter baumannii ATCC 17978|L-2-haloalkanoic acid dehalogenase
MLQSYINDFNKFSTAFENAPKTIQNLHAQGYTLGLVSNGKTPFQEKNFYALELTDYFSIIVISEAIGLRKPDPEIYLYTCNQLDCKPSDCIFIGDNPKADIEGAKKIGMKTIYFHPTLTLHPSLSDASIHHYDELEETVRRLINPPHF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.55 | 0.00018 | ●○○○○ -0.59 | -0.5856502605581562 | 24895306 |
Retrieved 1 of 1 entries in 9.2 ms
(Link to these results)