Bacterial taxon 400667
Locus A1S_0156
Protein ABO10639.2
membrane-bound ATP synthase F1 sector, epsilon-subunit
Acinetobacter baumannii ATCC 17978
Length 139 aa, Gene atpC, UniProt A3M145
>ABO10639.2|Acinetobacter baumannii ATCC 17978|membrane-bound ATP synthase F1 sector, epsilon-subunit
MATMQCDVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLLQPGPIRVLLENGTEEIVYVSGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAEQLLANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1 | 0.043 | ●●○○○ -1.24 | -1.2355768105398317 | 24895306 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)