Bacterial taxon 400667
Locus A1S_2324
Protein ABO12746.2
methionine aminopeptidase
Acinetobacter baumannii ATCC 17978
Length 275 aa, Gene n/a, UniProt n/a
>ABO12746.2|Acinetobacter baumannii ATCC 17978|methionine aminopeptidase
MNSTYTAPRRLIKTPDEIEKMRIAGRLAAEVLDMIKPHIKAGVSTLELDTICRNHIENVQHAIPACVGYGGAPGRPAFQHSICTSVNHVVCHGIPSENKILKNGDILNIDVTVIKDGYHGDTNMMYIVGGETSILANRLCKVAQEAMYRGMATVRDGSYLGDIGHAIQKYVESERFSVVREYCGHGIGTVFHDEPQVLHYGQAGTGMRLEAGMTFTIEPMVNAGVWQTKLLGDKWTVVTKDHKLSAQYEHTILVTKTGIEVLTARPEEDLSRFNQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.13 | 2.1e-9 | ●●○○○ -1.43 | -1.4310933836779056 | 24895306 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)