Bacterial taxon 400667
Locus A1S_1547
Protein ABO11974.1
organic solvent tolerance protein precursor
Acinetobacter baumannii ATCC 17978
Length 169 aa, Gene n/a, UniProt n/a
>ABO11974.1|Acinetobacter baumannii ATCC 17978|organic solvent tolerance protein precursor
MVNETMKHQFKFNPLATAIFTLLCSGSIQSSYAESAGVVSNIDNNQLKASIKEAYPGQEFFQQYYVDKSAPEAQLRNNKYLSSAFCQGTWITPINPETKALDADKATSVVTADYGHYNPAGDSVLEGNVVIDQEGRTVRADKVTIDKTQTFAHAQGRVQLAQGGLLSTK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.12 | 1.1e-14 | ●●●○○ -2.87 | -2.867651335878073 | 24895306 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)