Bacterial taxon 400667
Locus A1S_0826
Protein ABO11264.1
peptidyl-tRNA hydrolase
Acinetobacter baumannii ATCC 17978
Length 95 aa, Gene n/a, UniProt n/a
>ABO11264.1|Acinetobacter baumannii ATCC 17978|peptidyl-tRNA hydrolase
MNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSSEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.98 | 2.0e-12 | ●●●○○ -2.68 | -2.6754251982940933 | 24895306 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)