Bacterial taxon 400667
Locus A1S_2016
Protein ABO12443.2
Phage-related lysozyme
Acinetobacter baumannii ATCC 17978
Length 169 aa, Gene n/a, UniProt n/a
>ABO12443.2|Acinetobacter baumannii ATCC 17978|Phage-related lysozyme
MSNKTKYIAAVLAASAAFFVGVKNDEGFTSKPVIPVKGDRPTQGHGSTFKPNGSPVKMTDPPITRATADKWLRNDVAKREVAFKDSLKGVKLSQTEYDLYLDFTYQYGIGAWSGSSMLKNLKLGKYKAACDSLLKWKYVAKRDCSIRKNGCYGVWTRQLERHAKCIGAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.14 | 0.024 | ●●○○○ -1.45 | -1.4466842212286612 | 24895306 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)