Bacterial taxon 400667
Locus A1S_2964
Protein ABO13367.1
phosphoribosylaminoimidazole carboxylase mutase subunit
Acinetobacter baumannii ATCC 17978
Length 155 aa, Gene n/a, UniProt n/a
>ABO13367.1|Acinetobacter baumannii ATCC 17978|phosphoribosylaminoimidazole carboxylase mutase subunit
MGSQSDWATLEHTANMLKQLGVPFEAEVVSAHRTPDRLFEYAETARDRGIQVIIAGAGGAAHLPGMCAAKTDLPVLGVPVKSSILNGVDSLLSIVQMPAGIAVGTLAIGPAGATNAAIMAAQILGLTRPEIAKNVADFRAAQTDKVASNNIPGQV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.2 | 1.9e-28 | ●●●●● -4.44 | -4.443126468852604 | 24895306 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)