Bacterial taxon 400667
Locus A1S_3425
Protein ABO13814.2
phosphoribosylaminoimidazole-succinocarboxamide synthase
Acinetobacter baumannii ATCC 17978
Length 239 aa, Gene purC, UniProt A3MA70
>ABO13814.2|Acinetobacter baumannii ATCC 17978|phosphoribosylaminoimidazole-succinocarboxamide synthase
MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDRKGKVNNRFNAFIMEKLAEAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFELFYKDDGLGDPMVNESQAIALGWATAEQLEQMKVLTYKVNDVLKALFAEGNMILVDFKLEFGVFHDRIVLGDEFSPDGCRLWDKDTKKKLDKDRFRQGLGGVVEAYEEVAARLGVDLSDI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.81 | 2.4e-32 | ●●●●○ -3.88 | -3.879098303396559 | 24895306 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)