Bacterial taxon 400667
Locus A1S_1960
Protein ABO12387.2
predicted hydrolase (HAD superfamily)
Acinetobacter baumannii ATCC 17978
Length 220 aa, Gene n/a, UniProt n/a
>ABO12387.2|Acinetobacter baumannii ATCC 17978|predicted hydrolase (HAD superfamily)
MDGTLLDLAFDDFIWNECLPKRHSETHHLSLTESQEILNQFYRSHKHTLAWYSSNYWTQTTGVDVLKLQQEFQHKIKARPGCMELLSALKAQDYQCWLVTNADCASLKLKLDNVPIQDFFEVIVSSEQIGYAKEDIQFWKELQRLHHFAPESTIFLDDTLPVLKTAEKFGIRHLFTILQPSSLKSIRQPQDLEYKALGQLTELLSILNQIDRKDNDVKIA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.39 | 0.038 | ○○○○○ 0.78 | 0.7845872225786376 | 24895306 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)