Bacterial taxon 400667
Locus A1S_2377
Protein ABO12796.1
putative ABC transporter
Acinetobacter baumannii ATCC 17978
Length 175 aa, Gene n/a, UniProt n/a
>ABO12796.1|Acinetobacter baumannii ATCC 17978|putative ABC transporter
MTPSLRLGHGLDYVAAGRAAATRLSAFLKEPVLSSGNLQQIEEDVTLEIVNASFAIENQKVFDRLSYSFPKNSMTAITGPSGVGKTTLLRALAGLAVLQEGVVQLAKTDILQLHEKLRHEKVLFIPQGGDVLPTTVRENLSLSAINVSDEQLEQALLKAQLKVDLNADATFTFRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.67 | 0.037 | ●○○○○ -0.75 | -0.7540617494858003 | 24895306 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)