Bacterial taxon 400667
Locus A1S_0873
Protein ABO11305.2
putative arginine-tRNA-protein transferase
Acinetobacter baumannii ATCC 17978
Length 271 aa, Gene bpt, UniProt A3M311
>ABO11305.2|Acinetobacter baumannii ATCC 17978|putative arginine-tRNA-protein transferase
MKSYHPKSLLNDLQYYITPPHDCSYLENKSARMVFLDPIHRIDVVTLSELSRLGFRRSGDFVYRPECHLCRQCLSCRVPVADFQMNSMQKKAWKRNQDLTMTVLPTRQASQIHYDLYERYINERHADGDMFPPSLDQFEKFLVHSCTDSFFLELWKDNRLISVSTCDLMDDGLSAVYTFFDPDEHRRSLGVYSILNQIEYVKTLGLEYVYLGYWVPHSAKMNYKSQYTPLELLLDGQWRRLNRSLSPEEINQLGNSLMTTLPSEWNNLIIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.51 | 0.0007 | ●○○○○ -0.53 | -0.5273795816209316 | 24895306 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)