Bacterial taxon 400667
Locus A1S_1722
Protein ABO12149.2
putative ATP-binding component of ABC transporter
Acinetobacter baumannii ATCC 17978
Length 279 aa, Gene n/a, UniProt n/a
>ABO12149.2|Acinetobacter baumannii ATCC 17978|putative ATP-binding component of ABC transporter
MSITQGHVRIQNLSLHLGQAKNRFQALDRVNFEIQPGEFICLLGPSGCGKSTLLGALAGHLPISSGSLTVDDESIFEPHPDRGLVFQQHTLFPWKSVLENIAFGLKMKGIAKQKRIEQAQKMIDLVGLKGFEHKFPAELSGGMQQRVEIARVLINQPRILLMDEPFGALDAQTRLKMQMLLLEIWQEIQTSVLFITHDIDEALFLADRVLIMSHRPGRIIEEISLKFERPRDVELVTSSEFTAIKKHCIQTLKEATQQEELSRLNPLGLGKKSQIKEYE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.46 | 0.033 | ○○○○○ 0.88 | 0.8795496572443494 | 24895306 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)