Bacterial taxon 400667
Locus A1S_0454
Protein ABO10909.2
putative biopolymer transport protein (ExbD)
Acinetobacter baumannii ATCC 17978
Length 134 aa, Gene n/a, UniProt n/a
>ABO10909.2|Acinetobacter baumannii ATCC 17978|putative biopolymer transport protein (ExbD)
MAFQLGEDHDSGMNEMNLIPLIDIMLVLMIIFLVTATVANPSIPLTLPKTTAEIIDPPPKAITISINANGEVAWDTQVISLDELQKRFQEAGQGAVKPTVQLRADKESKYDTVAQVMSRASEAGLSDIAFVSEN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.17 | 2.5e-12 | ●●●○○ -2.95 | -2.94924141835739 | 24895306 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)