Bacterial taxon 400667
Locus A1S_1198
Protein ABO11628.1
putative extracellular nuclease
Acinetobacter baumannii ATCC 17978
Length 298 aa, Gene n/a, UniProt n/a
>ABO11628.1|Acinetobacter baumannii ATCC 17978|putative extracellular nuclease
MEIANNGYGPNSAIAHLTSALGPDWKYVIPENLDRLGSDVIAVAIIYNSKRVKPLNKAVVLDLGDKNRTTLAQTFQAVRGNKTFTVIPNHLKSKGCSGVDANSSDADQNDGQGCWNPTRVKAVDQIVQWLAKNPTQVPKQNALLVGDMNSYAKEAPILAFEKANYKVLLNDAKVGQGAQAYSYVFGVASDANGNGGAGNLDHAIADADLYPKVVRTFAWHINADEPTVLDYNEEYKTDEQKALFYGEDAYRSSDHDPVIVDLDLNGKDSNQPNDNQKSPIFDFLSQLMEWISQLFKRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.58 | 1.5e-31 | ●●●○○ -2.09 | -2.093471020593794 | 24895306 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)