Bacterial taxon 400667
Locus A1S_0979
Protein ABO11411.2
putative membrane-bound protein in GNT I transport system (GntY)
Acinetobacter baumannii ATCC 17978
Length 212 aa, Gene nfuA, UniProt A3M3B7
>ABO11411.2|Acinetobacter baumannii ATCC 17978|putative membrane-bound protein in GNT I transport system (GntY)
MSTENTNTAVAEEIPNLLITPSAQEYLHELLAKQNTPGIGVRIFVEHPGTPRAECCMAYSAPEEVVPTDYKQDYPDFPAYIDAPSIPYLLDAVIDYNKDRFGGQLTFRAPNSKVPRVGPDASIEERITYVLQAEINPGLAGHGGNCSLVEVQDDPEHGLTAVLKFGGGCQGCSAIDVTLKQGVETTLKEHIPELQRVVDQTDHTQAEGAYFK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2 | 3.6e-21 | ●●●○○ -2.7 | -2.7003966970918754 | 24895306 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)