Bacterial taxon 400667
Locus A1S_0231
Protein ABO10706.2
putative periplasmic carboxyl-terminal protease
Acinetobacter baumannii ATCC 17978
Length 394 aa, Gene n/a, UniProt n/a
>ABO10706.2|Acinetobacter baumannii ATCC 17978|putative periplasmic carboxyl-terminal protease
MLQHNIYKAFFVSVLMCCSQLVFSAPVVKEKLSPLHPDSPESEESYAEVPIESIQQFVQIYGIVRDNYVDEKSDDALFLQAIKGLVSGLDRYSRYLSAEEYRQLIQYTEGDLASVDFVLSPESHVHKWMIRDLKTGSDSYKLGLRNGQTILKIDNQELKNLTHDQVLGLLYGSIGSTLQVQTEESNSPISLVRNKKIETDIEPVMLHNQVLVLKIRVFQQDTANEIKRLIEENSSSRLKAVLIDLRNNPGGLLSAAVESADLFLNHGIIVSTKSRSEGNQQFQALPGNDFQNIKVGILINHRSASAAEVFTAAMKEHQRAWVMGEKSYGKGVVQKLFPLPSGAALQMTVSHYYTPNGNMIEGQGIQPNQTYPLPPEMKEEVYLDRVADLLLKRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.52 | 0.0012 | ●●●○○ -2 | -2.004409013779789 | 24895306 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)