Bacterial taxon 400667
Locus A1S_2256
Protein ABO12679.2
putative phosphohistidine phosphatase
Acinetobacter baumannii ATCC 17978
Length 151 aa, Gene n/a, UniProt n/a
>ABO12679.2|Acinetobacter baumannii ATCC 17978|putative phosphohistidine phosphatase
MQLTLVRHGEAAPPVNGNDIKRPLTARGHAQAEQTATFLKDIVKPDIFVVSPLLRAQETLAHIQTYFKDVPVLLCDKIKPDDDAKEAIEWLSQIPYESIVVVCHMNVVGHIAELLTHENFNPFALAEARIYDQAVIANGLSTQKNSFIPTI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.81 | 6.4e-16 | ●●●○○ -2.42 | -2.419968736833262 | 24895306 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)