Bacterial taxon 400667
Locus A1S_2564
Protein ABO12981.1
putative siderophore-interacting protein
Acinetobacter baumannii ATCC 17978
Length 145 aa, Gene n/a, UniProt n/a
>ABO12981.1|Acinetobacter baumannii ATCC 17978|putative siderophore-interacting protein
MDHVNQDHRKELLIIAQTYGKNNDIHDAVIADIYEEGILLNTQVPSSSIKQDLFIHFELKGDLEEQILYLAYNSFAKQKIEFSNNAKQFFEVVAKSQVTPNITRLTIKSQIPLPNYYAGYAYGFILKVVEKYLWYSRVLRIKVTP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.21 | 1.5e-8 | ●●○○○ -1.55 | -1.554751017007254 | 24895306 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)