Bacterial taxon 400667
Locus A1S_1789
Protein ABO12216.2
putative transcriptional regulator
Acinetobacter baumannii ATCC 17978
Length 294 aa, Gene n/a, UniProt n/a
>ABO12216.2|Acinetobacter baumannii ATCC 17978|putative transcriptional regulator
MANRSNHNQELAQLVDQWTREKGTFETAITGLTLYRAETLTKPSSSMMDASLCMIAQGKKQVILSEETYTYDSNHFLFTAIDLPVIAQVLEASVEQPYLSIVLRLDPYLLAQIMLEAHIPFKDVNTEKKGMAVGVVNSELNDAFIRLIKLLDTPQDIPILSPLIIKEIFYRLLMSPQGDRLKRIVAAGTTGHRIVKAIEWLKTNFAKPFSIEELASTMGMSASSFHQHFRDITSMSPLQYQKRMRLTEARRLLMTEEYDISSTSMQVGYESLSQFSREYKRFFGVSPSVDIKNI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.48 | 0.0024 | ○○○○○ 0.91 | 0.9093763363654666 | 24895306 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)