Bacterial taxon 400667
Locus A1S_1471
Protein ABO11899.1
putative transcriptional regulator (AraC family)
Acinetobacter baumannii ATCC 17978
Length 199 aa, Gene n/a, UniProt n/a
>ABO11899.1|Acinetobacter baumannii ATCC 17978|putative transcriptional regulator (AraC family)
MPNQAWSYQMLHLDLAWLNQLYSEFQEQGLDLHIPQHKPLIIKDEFLYDAFTEMNETLFDAQKLIFEKEQSLLHCLIHLLLPHFILEEIQKPQYLYKDFLNLIDVISSSEGFISLEELAQRVGLSRYAIIRLFKANVGLTPHAFQINLKINQAREQLKKGVPLAELAVNLGFSDQSHFHKAFKAHTGVTPRQFQLAAAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.42 | 0.0092 | ○○○○○ 0.83 | 0.8253635895041348 | 24895306 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)