Bacterial taxon 400667
Locus A1S_2072
Protein ABO12499.2
putative universal stress protein family
Acinetobacter baumannii ATCC 17978
Length 147 aa, Gene n/a, UniProt n/a
>ABO12499.2|Acinetobacter baumannii ATCC 17978|putative universal stress protein family
MNYRHIIVPVDGSEISLAAARQAAHIAKAFGSKLTAISLVAVDPFSGVDFYYISPVVKDYFVEARANAEKTLAKVKALCAEEGVDIETQIIQGEISSDGILKAVEELGSDLIVIGSHGRKGFQKLILGSFAQDVLNSTKIQVLVVKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.43 | 0.0083 | ○○○○○ 0.84 | 0.8368376663755636 | 24895306 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)