Bacterial taxon 400667
Locus A1S_0045
Protein ABO10540.2
regulating N-acetyl-anhydromuramyl-L-alanine amidase
Acinetobacter baumannii ATCC 17978
Length 189 aa, Gene n/a, UniProt n/a
>ABO10540.2|Acinetobacter baumannii ATCC 17978|regulating N-acetyl-anhydromuramyl-L-alanine amidase
MKQITPYEVIDGQLKGARQVPSPNFNQRPAGTEIQMIVVHNISLPPSQFGGGYIEQFFQNKLDWSVHPYFQTIEGMQVSTHLLILRTGEVLQFVNFNDRAWHAGRSSYLAKVECNDYSIGIELEGSDDLPFEDVQYEVLTDVVTAIRQAYPEIKNHIAGHSDIAPGRKTDPGPYFKWQHFRQLLAQKKT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.06 | 0.00013 | ●●○○○ -1.33 | -1.3254323414251117 | 24895306 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)