Bacterial taxon 400667
Locus A1S_0236
Protein ABO10711.2
response regulator
Acinetobacter baumannii ATCC 17978
Length 211 aa, Gene n/a, UniProt n/a
>ABO10711.2|Acinetobacter baumannii ATCC 17978|response regulator
MITVLVVDDHELVRTGICRMLEDHADVEVIGQAESGEEAIAIVRQQHPQVVLLDVNMPGIGGVETTRRLLQTAPETKVIAVSGLAEEPYPSLLLKAGAKGYITKGAPIAEMVRAINKVMQGGKYFSADIAEQLASSYLSDTQQSPFDSLSEREMQVAMMVVNCISAQEIADKLFVSVKTVNTYRYRIFEKLGIDSDVKLTHLAIRYGLIKP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.58 | 1.8e-30 | ●●●●○ -3.54 | -3.5416379928844672 | 24895306 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)