Bacterial taxon 400667
Locus A1S_3171
Protein ABO13568.1
RNA polymerase omega subunit
Acinetobacter baumannii ATCC 17978
Length 92 aa, Gene rpoZ, UniProt A3M9H4
>ABO13568.1|Acinetobacter baumannii ATCC 17978|RNA polymerase omega subunit
MARVTVEDCLDHVDNRFELVLVASKRARQLARQGMEPTVEWDNDKPTVVALREIAVGHVTKEILKQREQDYQTSSLDLALSTNSLNLEGFSF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.49 | 1.5e-21 | ●●○○○ -1.96 | -1.9593123518984816 | 24895306 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)