Bacterial taxon 400667
Locus A1S_0995
Protein ABO11427.1
rubredoxin
Acinetobacter baumannii ATCC 17978
Length 54 aa, Gene n/a, UniProt n/a
>ABO11427.1|Acinetobacter baumannii ATCC 17978|rubredoxin
MKKYQCIVCGWIYDEAEGWPQDGIAAGTKWEDIPDDWTCPDCGVSKADFEMIEI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.02 | 1.1e-11 | ○○○○○ 1.7 | 1.7023376364945473 | 24895306 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)