Bacterial taxon 400667
Locus A1S_2534
Protein ABO12951.2
sulfate transport protein
Acinetobacter baumannii ATCC 17978
Length 277 aa, Gene n/a, UniProt n/a
>ABO12951.2|Acinetobacter baumannii ATCC 17978|sulfate transport protein
MSQRSRVLPGFGLSLGFTLAYVSFIVLIPLAAVFIKSFGIGWDGLWEILTSERILKSLQLSFSSALIAAFINVVFGLLLAWCLVRYNFPGKRLVDALVDLPFALPTAVAGIALTSLYAPTGWIGQYLEPLGIQVAYTPIGITLALVFIGIPFIVRTVQPVLSDIETELEEAASALGANRWQTITKIILPILLPALFTGFALAFARGVGEYGSVIFIAGNQPFKTEIAPLMIISRLEEYDYAGATTIAAVMLVLSFIILFVINLLQAWANRRTGRNVT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.38 | 1.2e-48 | ●●●●○ -3.25 | -3.2503274355278626 | 24895306 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)