Bacterial taxon 400667
Locus A1S_2343
Protein ABO12765.2
superoxide dismutase
Acinetobacter baumannii ATCC 17978
Length 208 aa, Gene n/a, UniProt n/a
>ABO12765.2|Acinetobacter baumannii ATCC 17978|superoxide dismutase
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKATAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAAATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPKYIATFLENLVNWDYANAKLAGQPAGVEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.3 | 1.4e-7 | ●●○○○ -1.67 | -1.6736011031301508 | 24895306 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)