Bacterial taxon 400667
Locus A1S_0486
Protein ABO10941.2
thermoresistant gluconokinase
Acinetobacter baumannii ATCC 17978
Length 170 aa, Gene n/a, UniProt n/a
>ABO10941.2|Acinetobacter baumannii ATCC 17978|thermoresistant gluconokinase
MIVIAMGVCGTGKTLIGELLSERLACEFLDGDTLHSAANKSKMSQGIPLTDEDRLPWLQAIRQAIEAKQRDGETAVFTCSSLKRMYRDILRGQDQNVKFVYLKGSYELLQQRLAERSGHFFDPALLQTQLDTLEEPDVNEAIAIDIALTPEQIIEQVIQKLGVTDSVCRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.71 | 4.6e-7 | ○○○○○ 1.24 | 1.24464027657466 | 24895306 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)