Bacterial taxon 400667
Locus A1S_0145
Protein ABO10628.2
transcriptional repressor of Zn transport system (Fur family)
Acinetobacter baumannii ATCC 17978
Length 161 aa, Gene n/a, UniProt n/a
>ABO10628.2|Acinetobacter baumannii ATCC 17978|transcriptional repressor of Zn transport system (Fur family)
MHEHHDSLHGVHDHHNVASRLAEAETLCTAVGARLTPLRKEVLELILNASGPMGAYDLLARIKSQTDRPAAPPTVYRTLDFLLEKGLIHRLTSINAYIPCCHPREGHQAAFLICTECHTVKEASSQGLTQQLDQLAALDDFAAQHSIIEISGKCQQCRTAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.98 | 5.5e-7 | ●●○○○ -1.21 | -1.2052769099949507 | 24895306 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)