Bacterial taxon 354242
Locus CJJ81176_0196
Protein WP_002857378.1
7-carboxy-7-deazaguanine synthase QueE
Campylobacter jejuni subsp. jejuni 81-176
Length 247 aa, Gene queE, UniProt A0A0H3PAN0
>WP_002857378.1|Campylobacter jejuni subsp. jejuni 81-176|7-carboxy-7-deazaguanine synthase QueE
MQLVESFLSIQGEGKYNGKLAIFMRFAGCNFNCLGFNVKISKNDKTLIGCDTIRAVFTKDFKESYETLNANELLKRVIKLKQDFNPIVVITGGEPLIHYENPEFIKFIQMLLKNKFEIHFESNGSIEIDFDRYPFYKECIFALSVKLQNSGIKKDKRLNFKALKAFKNYAKDSFYKFVLDANTLDNSFLEINEILKEAPNQIFCMPMGENEQNLKKNAQKIAEFCIKNGYNYSDRIHIRLWNDKEGV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 7 days | not available in this study | -7.48 | 0.014 | ●●●○○ -2.32 | -2.31652076141 | 28542173 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)