Bacterial taxon 354242
Locus CJJ81176_0558
Protein WP_002869310.1
ADP-forming succinate--CoA ligase subunit beta
Campylobacter jejuni subsp. jejuni 81-176
Length 387 aa, Gene sucC, UniProt A1VYP2
>WP_002869310.1|Campylobacter jejuni subsp. jejuni 81-176|ADP-forming succinate--CoA ligase subunit beta
MNIHEYQAKAIFADNSIPTLKGKVAFSVDEAVANAKELGGSVWAVKAQIHAGGRGLGGGVKIAKNLDEVKDYASKILGMNLVTHQTGPEGKLVQKLYIESGANIVKEYYLAILFNRMAEQITIIASSEGGMDIEKVAKESPEKIAKVGIDPQIGFKMFHGLEVAKVLGLDKDESKKLISMIAKLYKLYMDKDMNMLEINPLIKTAEGDFYALDAKCSFDDSALYRHPEIAELRDITEENPAEREAAEFGLSYVKLDGDVACMVNGAGLAMATMDIINYSGAKPANFLDVGGGASAETVAKAFEIILRDKNVKVIFINIFGGIVRCDRIANGILEATKNVEVNIPIVVRLDGTNAAEAKTILDNSNLKNIKAATNLKNGAELVKSLVG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 21 days | not available in this study | -7.25 | 0.018 | ●●●○○ -2.2 | -2.19926356122 | 28542173 |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 7 days | not available in this study | -6.89 | 0.028 | ●●●○○ -2.01 | -2.00903114144 | 28542173 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)