Bacterial taxon 354242
Locus CJJ81176_0541
Protein WP_002857003.1
phosphoribosylformylglycinamidine synthase, purS protein
Campylobacter jejuni subsp. jejuni 81-176
Length 81 aa, Gene purS, UniProt A0A0H3PBK5
>WP_002857003.1|Campylobacter jejuni subsp. jejuni 81-176|phosphoribosylformylglycinamidine synthase, purS protein
MEVIVNISLKNGVLDPQGKAVEKALHSLNFNSVKEVKIAKQIKISLDEKDEKLAKEQVKKMCEELLVNSVIEDYELVIEKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 7 days | not available in this study | -6.99 | 0.025 | ●●●○○ -2.06 | -2.06355277723 | 28542173 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)