Bacterial taxon 354242
Locus CJJ81176_0517
Protein WP_002857358.1
YkgJ family cysteine cluster protein
Campylobacter jejuni subsp. jejuni 81-176
Length 124 aa, Gene n/a, UniProt A0A0H3PBP7
>WP_002857358.1|Campylobacter jejuni subsp. jejuni 81-176|YkgJ family cysteine cluster protein
MIFDKNFSYAFDENACEKCGGKCCTGESGNIFASKEELEALRKHLKLESKEFAEKYLRKVGFKMSFKEVEFEDGFACIFFDTQKRNCSIYDFRPKQCRTFPFWEYFKTHQKELEKECIGICYLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | cecum | BTO:0000166 | 7 days | not available in this study | -6.52 | 0.04 | ●●○○○ -1.82 | -1.81687922744 | 28542173 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)