Bacterial taxon 199310
Locus c3025
Protein AAN81475.1
Hypothetical protein yfgI
Escherichia coli CFT073
Length 179 aa, Gene yfgI, UniProt A0A0H2V9E3
>AAN81475.1|Escherichia coli CFT073|Hypothetical protein yfgI
MKKVFLCAILASLSYPAIASSLQDQLSAVAEAEQQGKNEEQRQHDEWVAERNREIQQEKQRRANAQAAANKRAATAAANKKARQDKLDAEATADKKRDQSYEDELRSLEIQKQKLALAKEEARVKRENEFIDQELKHKAAQTDVVQSEADANRNMTEGGRDLMKSVGKAEENKSDSWFN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus CBA/J) | spleen | BTO:0001281 | 24 h | 2,887,795 | -2.24 | 0.032 | ●●○○○ -1.03 | -1.0308929087570304 | 24339777 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)