Bacterial taxon 1392858
Locus CO715_00465
Protein ATI04339.1
2,3-diketo-L-gulonate TRAP transporter permease
Escherichia coli M12
Length 157 aa, Gene n/a, UniProt n/a
>ATI04339.1|Escherichia coli M12|2,3-diketo-L-gulonate TRAP transporter permease
MKKILEAILAINLAVLSCIVFINIILRYGFQTSILSVDELSRYLFVWLTFIGAIVAFMDNAHVQVTFLVEKLSPAWQRRVALVTHSLILFICGALAWGATLKTIQDWSDYSPILGLPIGLMYAACLPTSLVIAFFELRHLYQLITRSNSLTSPPQGA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.28 | 2.9e-10 | ○○○○○ 0.81 | 0.8129753827422798 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 4.7 | 8.5e-117 | ○○○○○ 1.53 | 1.5267533974876342 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)